PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g17302.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 82aa    MW: 9403.39 Da    PI: 3.9728
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g17302.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR122.63.5e-072557133
              FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtf 33
                      +fYn+YA e GFsvrks+ +  + n+ei+++ +
  Bradi3g17302.1.p 25 EFYNSYALEKGFSVRKSYVEWDEANQEIIMKLY 57
                      6*********************9***9998866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.3E-52557IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
MVDESVDEYL DIVGKMFGSE DDGFEFYNSY ALEKGFSVRK SYVEWDEANQ EIIMKLYDPT  60
GYYRGRAQDA CCLLSHIDAT Y*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231784.24e-27PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLI1IG643e-30I1IG64_BRADI; Uncharacterized protein
STRINGBRADI4G00925.17e-30(Brachypodium distachyon)
STRINGBRADI2G37795.11e-26(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2449976
Representative plantOGRP1143425